<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2 00p2-2 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 AZT+DDI 9
3 3TC+AZT 33
4 3TC+AZT+IDV 11
5 AZT+IDV 13
6 D4T+IDV 8
7 AZT+DDI+IDV 31
8 DDI+RTV+SQV 31
9 ABC+D4T+NFV 2
10 ABC+D4T+EFV+NFV 48
11 ABC+EFV+NFV 22
12 None 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, R41K, R57K, L63P, A71T, I72IV, I93L  
>00p2-2| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKTVGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210LW, T215TNSY   K101KPQT, K103KN   T39TA, E44ED, T69TA, A98AS, V118VI, K122KE, I135T, S162C, Q207QE, R211RK, L228LH, V245E, L283I, I293V  
>00p2-2| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKDGKISKIGPENPYNTPV
FAIKKKDSAKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLTKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008