<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2 99p2-1 Germany 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 AZT+DDI 9
3 3TC+AZT 33
4 3TC+AZT+IDV 11
5 AZT+IDV 13
6 D4T+IDV 8
7 AZT+DDI+IDV 31
8 DDI+RTV+SQV 31
9 ABC+D4T+NFV 2
10 ABC+D4T+EFV+NFV 48
11 ABC+EFV+NFV 10

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53L L10I, R41K, K55R, R57K, L63P, A71I, I72V, I93L, C95F  
>99p2-1| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGLVRVKQYD
QIPIEICGHKIVGTVLVGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, L210W, T215Y   K101P, K103N   T39A, E44D, A98S, V118I, K122E, I135T, S162C, Q207E, R211K, L228H, Q242QH, V245E, L283I, I293V  
>99p2-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHPSGLPKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VHPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008