<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1 05p1-3 Togo 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 94
2 D4T+APV+RTV+TDF 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, I84V N83D L10V, I13V, K14R, K20R, A22V, M36I, N37D, R41K, Q61H, H69K, K70R, L89I  
>05p1-3| codons 1-99
PQITLWQRPVVTVRIGGQLREVLLDTGADDTVLEEIDLPGKWKPKIIGGIGGFIKVRQYD
HILIEICGKRAIGTVLVGPTPADVIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       V35T, K43A, K49R, V60VI, D121H, K122E, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245K, K281R, T286A, I293V, P294T, E297K, S322T, I326V  
>05p1-3| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEAEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTEVVTLTKEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQ

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008