<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1 04p1-2 Togo 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 85

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A N83D L10V, I13V, K14R, K20R, M36I, N37D, R41K, Q61H, H69K, K70R, L89I  
>04p1-2| codons 1-99
PQITLWQRPVVTVRIGGQLREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
HILIEICGKRAIGTVLVGPTPADIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215CY       V35T, K43A, K49R, V60I, D121H, K122E, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245KQ, K281R, T286A, V292VI, I293V, P294T  
>04p1-2| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEAEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTEIVTLTEEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008