<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1 03p1-1 Togo 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20R, M36I, N37D, R41K, L63P, H69K, K70R, L89M  
>03p1-1| codons 1-99
PQITLWQRPLVTVRIGGQLREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215TA     V35T, E36D, K49R, V60I, D121H, K122E, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q, E248EDKN, K281R, T286A, I293V, P294T, I326V  
>03p1-1| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFATPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQ

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008