<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1451 CA13931 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+Unknown NA
2 3TC+D4T+IDV 47
3 D4T+DDI+NFV 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D I15V, K20KT, E35D, M36V, R57K, L63P, I85IV, Q92QR, I93L  
>CA13931| codons 1-99
PQITLWQRPFVTIKVGGQLTEALLDTGADNTVLEDVNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIVGRDLLTRLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F       E6D, K11R, K20R, K64R, T69N, R83K, A98S, T200I, Q207D, R211RK, K249R, A272P, K277R, T286A, I293V, E297R R72RG, K281KN
>CA13863| codons 1-303
PISPIDTVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSNRWGKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRDHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPERDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCNLLRGAKALTEVVPLTREAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005