<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4076 CA13930 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 NRTI NA
3 SQV 30
4 D4T+DDC+IDV 21
5 RTV+SQV 69
6 NFV+SQV 10
7 ABC+DDI+EFV 8
8 D4T+DDI+EFV 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, L63P, A71T, I85V, Q92R C95M
>CA13930| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNVVGRNLMTRIGMTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N V108I K43E, K122E, G196E, R211K, V245K, E248EK, T286A, I293IL, E297K  
>CA13878| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPKKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVLPLTKEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005