<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GH_205 GH_205 Ghana 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20I, E35D, M36I, R41K, L63T, I64M, H69K, K70R, L89M  
>GH_205| codons 1-99
PQITLWQRPLVTVKIEGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITMEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39M, K122E, D123KN, I135V, S162A, K173T, Q174K, D177E, I178M, G196GE, T200A, Q207E, P243T, V245Q, D250E, K281R, T286A, E291D, V292VI, I293V, S322T  
>GH_205| codons 1-323
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICMEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTK

References
Author Title Citation
Delgado, E High prevalence of unique recombinant forms of HIV-1 in Ghana: Molecular epidemiology from an antiretroviral resistance study. JAIDS, 2008