<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GH_194 GH_194 Ghana 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I I13V, K14R, L19V, K20I, E35ED, M36I, R41K, L63P, H69K, K70R, L89I  
>GH_194| codons 1-99
PQITLWQRPLITVRIGGQVIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32R, V35T, V60I, I135V, S162A, K173T, Q174K, N175NY, D177E, I178M, T200E, Q207T, R211K, V245Q, Y271F, T286A, E291D, I293V, P294T, L310I, S322T  
>GH_194| codons 1-325
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKYPEMVI
YQYMDDLYVGSDLEIGQHREKIEELRTHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIFAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREIIKEPVHGVYYDPTKDL

References
Author Title Citation
Delgado, E High prevalence of unique recombinant forms of HIV-1 in Ghana: Molecular epidemiology from an antiretroviral resistance study. JAIDS, 2008