<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4788 CA13923 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT NA
2 D4T+DDI+NFV NA
3 3TC+ABC+D4T+EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI   N37D, K43R, D60DE, L63S, A71V, I72AT, V75VI, V77I, Q92QP, I93L  
>CA13923| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWRPKIIGGIGGFIKVRQYE
QISIEICGHKVAGTILIGPTPVNIIGRNLLTPLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K65KR, T69D, T215F D67DG K103N, V106VM   K11KR, K20R, I135T, S162C, Q174K, Q207E, R211K, A272P, V276I, L283I, I293V T128TI
>CA13855| codons 1-293
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKRKGSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSVPL
DKDFRKYIAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGTKALTEVV

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005