<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GH_082 GH_082 Ghana 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN   K11T, E28K, K32E, V35T, E36A, T39K, K43E, D121H, K122E, I142V, S162H, K173S, Q174R, D177E, V179I, Q207A, R211K, F214L, V245Q, K275KQ, K277KR, K281R, T286A, E291D, I293V, P294A, E297K, E312D, I326V  
>GH_082| codons 1-326
PISPIETVPVTLKPGMDGPKVKQWPLTKEKIEALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQHSMTKILEPFRSRNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIQVRQLCRLLRGAKALTDVVALTKEAE
LELAENREILKDPVHGVYYDPSKDLV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, M36L, R41K, L63P, H69Q, L89M  
>GH_082| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Delgado, E High prevalence of unique recombinant forms of HIV-1 in Ghana: Molecular epidemiology from an antiretroviral resistance study. JAIDS, 2008