<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GH_075 GH_075 Ghana 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, K20R, M36I, R41K, L63V, H69K, L89M  
>GH_075| codons 1-99
PQITLWQRPVVTVRIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28A, K32Q, V35T, E36D, V60I, K122KE, I135V, S162A, K173T, D177K, G196GE, T200A, Q207E, R211K, V245Q, E248K, K277R, T286A, E291D, I293V, P294T, S322T, I326V  
>GH_075| codons 1-329
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIQALTDICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPKIVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPKKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEI

References
Author Title Citation
Delgado, E High prevalence of unique recombinant forms of HIV-1 in Ghana: Molecular epidemiology from an antiretroviral resistance study. JAIDS, 2008