<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GH_056 GH_056 Ghana 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, R41K, Q61N, L63A, A71T, I72IM, V77I  
>GH_056| codons 1-99
PQITLWQRPLVAIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
NIAIEICGHKTMGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, V60I, I135V, S162A, K173T, Q174K, D177E, T200S, Q207E, V245E, K281R, T286A, I293V, L295F  
>GH_056| codons 1-329
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRSKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTEVVPFTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEI

References
Author Title Citation
Delgado, E High prevalence of unique recombinant forms of HIV-1 in Ghana: Molecular epidemiology from an antiretroviral resistance study. JAIDS, 2008