<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GH_017 GH_017 Ghana 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20I, E35G, M36I, R41K, H69K, K70E, V77VI, L89M  
>GH_017| codons 1-99
PQITLWQRPLVTVRIEGQLIEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKEAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, I135V, S162A, F171Y, K173T, Q174K, D177E, Q207A, R211K, F214L, V245K, T286A, I293V, P294A, E312D, I326V  
>GH_017| codons 1-326
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPYRTKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVALTEEAE
LELAENREILKDPVHGVYYDPSKDLV

References
Author Title Citation
Delgado, E High prevalence of unique recombinant forms of HIV-1 in Ghana: Molecular epidemiology from an antiretroviral resistance study. JAIDS, 2008