<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9 PI-9 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14R, I15V, L19I, M36I, R41K, K43R, L63P, H69K, K70R, L89M, I93L  
>PI-9| codons 10-99
LVSIRVGGQIKEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYDQIPIEICGK
RAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Arora, SK Drug resistance-associated genotypic alterations in the pol gene of HIV type 1 isolates in ART-naive individuals in North India. ARHR, 2008