<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
24 PI-24 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14R, I15V, G16E, L19I, M36I, R41K, L63T, H69K, L89I, I93L  
>PI-24| codons 10-99
LVSIRVEGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQITIEICGK
KAIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D121H, K122E, I135R, K173A, D177E, T200A, Q207E, R211K  
>RT-24| codons 87-230
FWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSRNNETPGIRYQY
NVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELR
EHLLKWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Arora, SK Drug resistance-associated genotypic alterations in the pol gene of HIV type 1 isolates in ART-naive individuals in North India. ARHR, 2008