<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2 PI-2 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14R, I15V, L19I, M36I, N37S, R41K, L63A, H69K, L89M, I93L  
>PI-2| codons 10-99
LVSIRVGGQIKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYDQIAIEICGK
KAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K102Q, D121Y, K122E, S162A, K173T, T200A, Q207E, R211K W229F
>RT-2| codons 75-229
VDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPS
INNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPDIVIYQYMDDLYVGSDLE
IGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLF

References
Author Title Citation
Arora, SK Drug resistance-associated genotypic alterations in the pol gene of HIV type 1 isolates in ART-naive individuals in North India. ARHR, 2008