<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1260 CA13866 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 AZT+DDC 26
3 DDI 30
4 Unknown 57
5 3TC+AZT 13
6 3TC+AZT+SQV 26
7 3TC+D4T+SQV 61
8 3TC+D4T+NFV 11
9 3TC+D4T+EFV+RTV+SQV 28
10 3TC+D4T+EFV+Unknown 37
11 3TC+D4T+SQV 49

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LI, M184V, T215F K219Q Y181YC, G190GA   V35LM, E36EG, T39A, K49R, K64HY, V75X, V118I, D123E, S162D, T165TI, K166KR, E169D, D177E, V179I, G196E, I202IV, Q207H, R211K, F214L, D218DE, L228HN, A272P, T286A, I293X, E297K A299AG
>CA13866| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLGICAEMEKEGKISRIGPENPYNTPV
FAIHKKNSTRWRKIXDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMIRILDPFRKQNPEIII
CQYVDDLYVASDLEIEQHRTKVEELRHHLLKWGLFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVXPLTKEGE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M   L10I, L63P, A71V, I72IV, V77I, I93L  
>CA13932| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QIPIEICGHKVVGTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005