<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HM199 01AOHM199 Angola 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I3V, I13IV, G16E, R41K, L63A, I93M  
>01AOHM199| codons 1-99
PQVTLWQRPLVTVKIEGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLVGPTPVNIIGRNLLTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T7P, V35T, K49R, E53D, V60I, D121C, K122E, E169D, N175H, D177E, V179I, G196E, T200A, I202V, E204K, Q207E, R211K, F214L, V245E, D250E, A272P, Q278H, K281R, T286A, I293V, E297K, A304E  
>01AOHM199| codons 1-305
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPDNPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
CEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQHPEIII
YQYMDDLYVGSDLEIEQHRAKVEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVKHLCRLLRGAKALTEVVPLTKEAE
LELEE

References
Author Title Citation
Bartolo, I Antiretroviral drug resistance surveillance among treatment-naive human immunodeficiency virus type 1-infected individuals in Angola: evidence for low level of transmitted drug resistance. AAC, 2009