<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HJM63 01AOHJM63 Angola 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L19V, K20I, M36I, R41K, C67N, H69K, V82I, L89M  
>01AOHJM63| codons 1-99
PQITLWQRPIVTVKIGGQVIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEINGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, E40D, V60I, I135V, S162A, K173A, D177E, T200A, Q207A, V245E, D250E, T286A, E291D, V292I, I293V, E297A  
>01AOHJM63| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAE

References
Author Title Citation
Bartolo, I Antiretroviral drug resistance surveillance among treatment-naive human immunodeficiency virus type 1-infected individuals in Angola: evidence for low level of transmitted drug resistance. AAC, 2009