<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Mil-SA MilazzoSA1 Italy 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 3TC 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184V K219Q     K20R, K32N, T107TS, D123E, I135T, E138A, E203D, E204ED, F214L S68SC
>MilazzoSA1| codons 1-233
PISPIETVPVKLKPGMDGPRVKQWPLTEEKINALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNCTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVSVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDDLRQHLLRWGLTTPDQKHQKEPPFLWMGYE

References
Author Title Citation
Milazzo, L Evidence of stavudine-related phenotypic resistance among zidovudine-pretreated HIV-1-infected subjects receiving a therapeutic regimen of stavudine plus lamivudine. JAIDS, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005