<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HDC229 01AOHDC229 Angola 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12K, I13V, K14R, I15V, K20I, M36I, N37D, R41K, L63I, C67G, H69K, V82I, L89M  
>01AOHDC229| codons 1-99
PQITLWQRPVVKVRVGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QIIIEIGGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K20R, V35T, K49R, V60I, D121Y, K122E, D123G, D177E, I178M, V179I, T200E, E204N, Q207D, R211K, V245Q, T286A, E291D, V292I, I293V I2F, K13N, N57T
>01AOHDC229| codons 1-305
PFSPIETVPVTLNPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYTTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMII
YQYMDDLYVGSDLEIGQHREKIENLRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAE

References
Author Title Citation
Bartolo, I Antiretroviral drug resistance surveillance among treatment-naive human immunodeficiency virus type 1-infected individuals in Angola: evidence for low level of transmitted drug resistance. AAC, 2009