<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NV72 NV72 Spain 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11VI I13V, K14R, K20I, M36I, N37D, R41K, L63Q, I64IL, H69K, I72IM, L89M  
>NV72| codons 4-99
TLWQRPLITVRIGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYDQIQ
LEICGKKAMGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39R, E40D, K43Q, S48T, V60I, K122E, D123E, S162A, K173T, Q174K, T200A, Q207E, R211K, V245Q  
>NV72| codons 38-247
CRDMEQEGKITKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRTKNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
McConnell, MJ Molecular epidemiology of HIV type 1 in newly diagnosed patients in southern Spain. ARHR, 2008