<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Mil-CO MilazzoCO1 Italy 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 3TC 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q     V90I, D123E, I135T, S162H, V179I, Q207E, F214L Q161H
>MilazzoCO1| codons 1-233
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFHHSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGLFTPDQKHQKEPPFLWMGYE

References
Author Title Citation
Milazzo, L Evidence of stavudine-related phenotypic resistance among zidovudine-pretreated HIV-1-infected subjects receiving a therapeutic regimen of stavudine plus lamivudine. JAIDS, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005