<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL07_060 VL07_060 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19T, D25X, M36I, R41K, L63H, H69K, I72T, L89M, I93L  
>VL07_060| codons 1-99
PQITLWQRPLVTIKVGGQTKEALLETGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIHIEICGKKATGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Kandathil, AJ The frequency of HIV-I drug resistance mutations among treatment-naive individuals at a tertiary care centre in south India. Int J STD AIDS, 2009
Kandathil, AJ A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. ARHR, 2009