Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| VL05_173 | VL05_173 | India | 2005 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | None | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| T12P, I13V, I15V, G16E, Q18X, L19I, M36I, R41K, L63H, H69K, L89M, I93L |
| >VL05_173| codons 1-99 PQITLWQRPLVPVKVEGHIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF |
References
| Author | Title | Citation |
| Kandathil, AJ | The frequency of HIV-I drug resistance mutations among treatment-naive individuals at a tertiary care centre in south India. | Int J STD AIDS, 2009 |
| Kandathil, AJ | A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. | ARHR, 2009 |