<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL05_173 VL05_173 India 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I13V, I15V, G16E, Q18QH, L19I, M36I, R41K, L63H, H69K, L89M, I93L  
>VL05_173| codons 1-99
PQITLWQRPLVPVKVEGHIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, S48T, I50IFLV, V60I, L100LF, D121H, K122E, I135T, S162H, K173A, D177E, I178L, T200A, Q207E, V245Q, A272P, K277R, Q278QH, T286A, E291D, V292I, I293V  
>VL05_173| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGFKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRAQNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGAKALTDIVPLTEEAE

References
Author Title Citation
Kandathil, AJ The frequency of HIV-I drug resistance mutations among treatment-naive individuals at a tertiary care centre in South India. Int J STD AIDS, 2009
Kandathil, AJ A comparison of interpretation by three different HIV type 1 genotypic drug resistance algorithms using sequences from non-clade B HIV type 1 strains. ARHR, 2009