<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Gat-NR1 agaNR1 Japan 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 44
3 NFV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82T   L10R, I62V, L63P, A71T, V77I, I93L  
>agaNR1| codons 1-99
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLIGPTPTNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gatanaga, H Anti-HIV effect of saquinavir combined with ritonavir is limited by previous long-term therapy with protease inhibitors. ARHR, 1999
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005