Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| Gat-NR3 | agaNR3 | Japan | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
| 2 | SQV | 24 |
| 3 | NFV | 32 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, L90M | G73T | L10I, L63P, I64V, K70R, V77I |
| >agaNR3| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD QIPVEICGHRAITTVLIGPTPVNIIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Gatanaga, H | Anti-HIV effect of saquinavir combined with ritonavir is limited by previous long-term therapy with protease inhibitors. | ARHR, 1999 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |