<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3062 3062_98 Zimbabwe 1998 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22KE, K32I, V35K, E36A, T39E, G45GE, V60I, V118I, K122E, E138D, K173A, D177E, I178L, T200A, E204KR, Q207D, R211K, F214L  
>3062_98| codons 1-239
PISPIETVPVKLKPGMDGPKVEQWPLTEEKIIALKAICEEMEKEEKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNDTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPELVI
YQYMDDLYVGSDLEIGQHRAKIERLRDHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Dalai, SC Evolution and molecular epidemiology of subtype C HIV-1 in Zimbabwe. AIDS, 2009