<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Gat-NR7 agaNR706 Japan 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 32
3 RTV+SQV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, V82A, I84V, L90M F53L L10I, E34Q, N37D, K45N, L63P, A71V, V77I, I93L  
>agaNR706| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMDLPGRWKPNMIGGIGGLMKVRQYD
QIPIEICGHKVIGTVLIGPTPANVIGRNLMTQLGCTLNF

References
Author Title Citation
Gatanaga, H Anti-HIV effect of saquinavir combined with ritonavir is limited by previous long-term therapy with protease inhibitors. ARHR, 1999
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005