<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Gat-NR7 agaNR700 Japan 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2H, K14R, I15V, L19I, R41K, L63T, I93L Q61L
>agaNR700| codons 1-99
PHITLWQRPLVTIRVGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
LITIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gatanaga, H Anti-HIV effect of saquinavir combined with ritonavir is limited by previous long-term therapy with protease inhibitors. ARHR, 1999
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005