<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SC306 SC306_06 Zimbabwe 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, V35T, E36A, T39E, E40D, S48T, V118I, K122E, D123N, K173E, D177E, I178L, D192N, T200A, E204Q, Q207E, R211K, F214L D17A, H96HP
>SC306_06| codons 1-239
PISSIETVPVKLKPGMAGPKVKQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPPPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPELVI
YQYMDDLYVGSNLEIGQHRAKIEQLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Dalai, SC Evolution and molecular epidemiology of subtype C HIV-1 in Zimbabwe. AIDS, 2009
Tshabalala, M Surveillance of transmitted antiretroviral drug resistance among HIV-1 infected women attending antenatal clinics in Chitungwiza, Zimbabwe. PLoS ONE, 2011