<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA640 CA13760 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 52
2 3TC+AZT+SQV 61
3 3TC+AZT+IDV 39
4 3TC+D4T+RTV+SQV 22
5 AZT+DDI+NVP+RTV+SQV 49
6 3TC+AZT+EFV+RTV+SQV+Unknown 34
7 3TC+AZT+D4T+EFV+RTV+SQV 7
8 3TC+AZT+EFV+RTV+SQV 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, I84V K43T L10I, G17E, N37D, L63P, C67S, A71V, I72V, V77I, I93L  
>CA13760| codons 1-99
PQITLWQRPIVTIKIGEQLKEALLDTGADDTVLEEMDLPGRWTPKMIVGIGGFVKVRQYD
QIPIEISGHKVVGTVLIGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215Y   Y188L, G190A   S3C, E44D, D123E, I135T, I142T, D177E, V179I, G196E, R211K, L228R, D237E, K275Q  
>CA13676| codons 1-280
PICPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
YQYVDDLLVASDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFRWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIQVKQLC

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005