<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5532 CA13751 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 AZT+DDC 52
3 D4T+DDI 22
4 Unknown 83
5 3TC+AZT+NFV 101

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90LM N88ND L10I, I15V, K20T, M36MI, N37S, P39S, R57K, I62V, L63P, I64V, I93L  
>CA13751| codons 1-99
PQITLWQRPIVTIKVGGQLTEALLDTGADDTVLEEISLSGRWKPKLIGGIGGFIKVKQYD
QVPVEICGHKAIGTVLVGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K43Q, V118I, I142V, K166R, E204EQ, Q207E, R211K, A272P, K277R, Q278QH K259K*
>CA13667| codons 1-286
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEQLREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ*LVGKLNWASQIYPGIKVRHLCKLLRGT

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005