<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HT178 07TG.HT178 Togo 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13A, K14R, I15V, K20I, M36I, N37T, P39Q, R41K, L63P, H69K, L89M  
>07TG.HT178| codons 1-99
PQITLWQRPVVTARVGGQLIEALLDTGADDTVLEEITLQGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39M, K122V, D123N, I135L, S162A, K173T, Q174K, D177E, I178V, Q207E, R211K, V245Q, K281R, T286A, E291D, V292I, I293V, P294T, K311R, S322T, I326V, G335D, R356K, M357K, G359S, K366R, A371V, I375A, V381I, T386V, K390R, K395R, T403TM, E432D  
>07TG.HT178| codons 1-438
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DVNFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEVVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILREPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLTEVVQKAATESIIIWGKVPKFRLPIQRETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAE

References
Author Title Citation
Yaotse, DA Genetic characterization of HIV-1 strains in Togo reveals a high genetic complexity and genotypic drug-resistance mutations in ARV naive patients. Infect Genet Evol, 2009