<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HT076 06TG.HT076 Togo 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, L19P, K20I, E35D, M36I, R41K, L63P, H69K, K70R, L89I  
>06TG.HT076| codons 1-99
PQITLWQRPLVTARIGGQPIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, E36D, E40D, K64R, K122P, I135V, S162A, K173R, Q174K, D177E, T200A, E204K, Q207D, R211K, P243T, V245Q, K281R, T286A, E291D, V292I, I293V, S322T, I326V, G335D, R356K, M357K, G359S, A371V, I375V, T377I, K390R, E399D, T403M, E432D, V435I  
>06TG.HT076| codons 1-435
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTDICTDMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRRKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEKLRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVAIESIVIWGKTPKFRLPIQKETWDAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPII

References
Author Title Citation
Yaotse, DA Genetic characterization of HIV-1 strains in Togo reveals a high genetic complexity and genotypic drug-resistance mutations in ARV naive patients. Infect Genet Evol, 2009