Isolate Data
Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
RTV-231 | RTV231W32 | U.S. | 1994 | HIV1 | B | Plasma | None |
Treatment History
Order | Regimen | Weeks |
1 | RTV | 32 |
Protease Sequence
PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
V82F | I64V |
>RTV231W32| codons 1-99 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD QILVEICGHKAIGTVLVGPTPFNIIGRNLLTQIGCTLNF |
References
Author | Title | Citation |
Molla, A | Ordered accumulation of mutations in HIV protease confers resistance to ritonavir. | Nat Med, 1996 |
Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |