<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1420 CA13679 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 59
2 DDC 71
3 D4T 25
4 D4T+ SQV 6
5 D4T+ 3TC+ SQV 3
6 D4T+ 3TC+ RTV+ NVP 23
7 D4T+ RTV+ 3TC+ IDV 13
8 D4T+ 3TC+ IDV 40
9 D4T+ NFV+ 3TC 17
10 D4T+ NFV+ 3TC+ SQV 11
11 D4T+ NFV 6
12 D4T+ NFV 47
13 DDI+ 3TC+ APV 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y N348I K103N, Y181C   K20R, K43N, E44ED, V118I, K122E, V179I, G196E, E204K, Q207E, R211K, A272P, I293V, E297A, I329L, M357T, G359S, A376S, T386I, A400T, V435A, G436GE, D460N, V467I, S468P, H483HY, L491S, E492K N265NS, Q269QE
>CA13679| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVGSDLEIEQHRTKIEKLREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLSWASEIYPGIKVKQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKILKTGKYARTRSA
HTNDVKQLTEAVQKISTESIVIWGKIPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAEAETFYVDGAANRETKLGKAGYVTNRGRQKVIPLTDTTNQKTELQ
AIYLALQDSGSKVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L33F, G73S L10I, E35D, M36L, N37D, I62V, L63P, C67F, A71V  
>CA13764| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEDLDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEIFGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005