<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1259 CA13615 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 53
2 AZT+DDC 9
3 D4T 31
4 3TC+AZT 42
5 3TC+AZT+IDV 31
6 3TC+D4T+RTV+SQV 49
7 3TC+D4T+EFV+NFV+SQV 89

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215CY K219N L100I, K103N   E44D, V118I, K122E, D123E, D177E, I178M, H208Y, R211K, E248D, A272P, K277R, T286A, E297K  
>CA13615| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFCTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54V, V82A, I84V Q58E L10I, L63C, H69HY, A71V, V77I, Q92K, I93L  
>CA13627| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIVGIGGFVKVREYD
QICIEICGYKVIGTVLIGPTPANVIGRNLLTKLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005