<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1293 CA13599 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 52
2 3TC+D4T 52
3 3TC+D4T+IDV 52
4 3TC+D4T+NFV+NVP 151

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, L210W, T215Y   Y181C V108I, V179E V35I, K43Q, A98S, K102Q, V118I, D121C, K122E, I135T, I142V, T200A, K223Q, L228R, Q242L, V245M L234LH
>CA13599| codons 1-255
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKQKKSVTILDVGDAYFSIPL
CEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIEI
CQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTPDKKHQQEPPFRWMGYEHHPDKWT
VLPIMLPEKDSWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A L24I, L89V L10I, M36L, N37D, Q61E, I62V, L63P, I64M, A71V, I93L  
>CA13630| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEELDLPGRWKPKLIGGIGGFIKVRQYD
EVPMEICGHKVIGTVLVGPTPANIIGRNVLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005