<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5450 CA13597 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 35
2 D4T+IDV 95
3 DDC+NVP+RTV+SQV 18
4 ABC+DDI 57

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F D67S, K219Q     K20R, V60I, T69N, K103R, V118I, I135T, I142V, Q174R, V179I, G196E, E203D, R211K, F214L T131TA, W252L, T253D, V254C, N255Q
>CA13597| codons 1-255
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKSSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DKDFRKYTAFAIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIII
YQYMDDLYVGSDLEIEQHRTKIDELRQHLLKWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSLDCQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L90M   L10I, E35D, M36I, N37T, L63P, I64V, Q92K, I93L  
>CA13628| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDITLPGRWKPKLIGGIGGFVKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLMTKLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009