<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
009 VN009 Vietnam 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, R41K, H69K, L89M, F99FL  
>VN009| codons 4-99
TLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, T39K, K102KE, K122E, D123S, S162C, K173I, Q174K, D177E, I178M, Q207NS, R211S, K238R, V245EQ I37FL
>VN009| codons 30-247
QIGCTLNLCKEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKEKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQCSMTKILEPFRIKNPEMVIYQYMDDLYVGSDLEIGQHRTKIEELRSHL
LSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIQLP

References
Author Title Citation
Nguyen, HT HIV drug resistance threshold survey using specimens from voluntary counselling and testing sites in Hanoi, Vietnam. Antivir Ther, 2008