<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1543 CA13596 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 208
2 AZT+ DDC+ DDI+ NFV+ SQV NA
3 D4T+ 3TC+ IDV+ NVP 76
4 D4T+ RTV+ SQV+ DDI+ ADV 15
5 D4T+ RTV+ SQV+ DDI+ ADV+ NFV 3
6 D4T+ SQV+ DDI+ ADV+ NFV 13
7 None 3
8 D4T+ SQV+ DDI+ NFV 15
9 None 8
10 D4T+3TC+IDV+RTV+EFV 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215Y K219R     K43E, E44A, A98S, V118I, I135T, H208Y, R211E, L228H, V245L, A288S  
>CA13596| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWEWGFYTPDRKHQKEPPFHWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I64V  
>CA13005| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005