<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1829 CA13591 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 41
2 AZT+D4T+DDC 52
3 3TC+D4T 39
4 3TC+IDV 32
5 3TC+DLV+NFV 65
6 ADV+IDV+NFV+SQV 28
7 ABC+ADV+IDV+NFV+SQV 11
8 ABC+ADV 20
9 None 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, L210W A62V, D67E, T215C Y181C V108I K20R, K122E, D177E, L228H, V245E, A272P, I293V, E297KR  
>CA13591| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIKKKESTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFCTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V V32T L10X, K20R, M36I, I62V, L63P, I64V, A71V, I72IV, P79PA  
>CA13622| codons 1-99
PQITLWQRPXVTIKIGGQLREALLDTGADDTTLEEINLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKVVGTVLVGATPVNVIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005