<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
017 VN017 Vietnam 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, M36I, R41K, H69K, K70R, V82VI, L89M  
>VN017| codons 4-98
TLWQRPIVTVKIEGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLN

References
Author Title Citation
Nguyen, HT HIV drug resistance threshold survey using specimens from voluntary counselling and testing sites in Hanoi, Vietnam. Antivir Ther, 2008