<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2 2 Swaziland 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, M36I, D60E, Q61E, L63S, H69K, L89M, I93L  
>2| codons 1-99
PQITLWQRPLVSIKVGGQVKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, V35T, E36A, T39E, S48T, K122E, D123S, T139A, T200A, Q207E, R211K, F214L  
>2| codons 1-238
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Deho, L Subtype assignment and phylogenetic analysis of HIV type 1 strains in patients from Swaziland. ARHR, 2008