<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
152 152 Swaziland 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181I   I31R, V35I, E36A, T39E, S48T, K104R, V118I, K122E, D123N, T131P, E138A, T139S, K173T, Q174K, T200A, Q207E, R211K, F214L F130L, Q182K
>152| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKRKALIAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DENFRKYTALPIPSINNASPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
IKYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, D60E, Q61D, L63N, H69K, L89M, I93L  
>152| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
DINIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Deho, L Subtype assignment and phylogenetic analysis of HIV type 1 strains in patients from Swaziland. ARHR, 2008