<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TR208 TR208 Burkina Faso 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K20I, M36I, R41K, H69K, L89M  
>TR208| codons 1-99
PQITLWQRPLVTAKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219KQ     E28K, K32E, V35T, E36K, D123E, I135V, S162A, K173A, Q174K, D177E, T200A, Q207E, R211K, V245Q, P247T, T286A, E291D, V292I, I293V, P294T, L295M  
>TR208| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTKICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLTEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTMTEEAE
LELAENREILKEPVHGVYY

References
Author Title Citation
Tebit, DM Analysis of the diversity of the HIV-1 pol gene and drug resistance associated changes among drug-naive patients in Burkina Faso. J Med Virol, 2009