<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5468 CA13565 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 83
2 3TC+AZT+IDV 39
3 D4T+NFV+NVP 136

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, L90M K43T L63P, A71T  
>CA13565| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWTPKMIGGIGGFLKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F   K103N K238KT D123E, I135L, K166R, D177E, G196E, V245M, K277R, T286A, I293V, E297K A299AG
>CA13491| codons 2-303
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVF
AIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLD
KEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVIY
QYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDKKHQKEPPFLWMGYELHPDTWTV
QPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTKEGEL
EL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Rhee, SY Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. J Infect Dis, 2009