<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2256 CA13562 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 29
2 AZT+DDC 78
3 3TC+AZT+SQV 8
4 AZT 17
5 3TC+AZT+RTV 9
6 3TC+AZT 51
7 D4T+IDV 16
8 D4T+IDV+RTV 54
9 D4T+DDI+RTV+SQV 33
10 D4T+DDI+EFV+RTV+SQV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, L90M G73GS L10I, I15V, K20M, M36I, N37D, I62IV, L63P, A71V, I85V, Q92QK  
>CA13562| codons 1-99
PQITLWQRPIVTIKVGGQLMEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVISTVLVGPTPTNIVGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   L100I, K103N   K11KR, V35VI, K43N, E44ED, R83K, V118VI, K122KE, G196E, T200A, Q207E, R211K, L228HR, V245E, A272P, K277R, Q278H, T286A R72RG, D110DG
>CA13530| codons 1-286
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALIEICTELENDGKISKIGPENPYNTPV
FAIKKKDSTKWGKVVDFRELNKKTQDFWEVQLGIPHPAGIKKNKSVTVLGVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGA

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005